Antibodies

Jump to Filters
View as table Download
OMA1 Rabbit Polyclonal Antibody
TA340395

USD 375.00

In Stock

Rabbit Polyclonal Anti-OMA1 Antibody

Applications WB
Reactivities Fish, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-OMA1 antibody: synthetic peptide directed towards the middle region of human OMA1. Synthetic peptide located within the following region: WAICPRDSLALLCQWIQSKLQEYMFNRPYSRKLEAEADKIGLLLAAKACA
TRPM7 Goat Polyclonal Antibody
TA302721

USD 375.00

2 Weeks

Goat Polyclonal Antibody against TRPM7

Applications WB
Reactivities Mouse, Rat, CrayFish
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKESESTNSVRLML, from the C Terminus of the protein sequence according to NP_060142.2.