Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | MFN2 antibody was raised against a 17 amino acid peptide near the center of human MFN2. The immunogen is located within amino acids 250 - 300 of MFN2. |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFN2 antibody: synthetic peptide directed towards the N terminal of human MFN2. Synthetic peptide located within the following region: STVINAMLWDKVLPSGIGHTTNCFLRVEGTDGHEAFLLTEGSEEKRSAKT |
Rabbit Polyclonal Anti-MFN2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFN2 antibody: synthetic peptide directed towards the C terminal of human MFN2. Synthetic peptide located within the following region: LEQEIAAMNKKIEVLDSLQSKAKLLRNKAGWLDSELNMFTHQYLQPSR |
Rabbit polyclonal anti-Mitofusin 2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to residues surrounding amino acid 719 of human Mitofusin 2 |
Germany
Japan
United Kingdom
China
