Antibodies

View as table Download

Rabbit monoclonal anti-AAAT antibody for SISCAPA, clone OTIR5A7

Applications SISCAPA
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-SLC1A5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5. Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV

SLC1A5 / ASCT2 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen SLC1A5 / ASCT2 antibody was raised against synthetic 15 amino acid peptide from C-Terminus of human SLC1A5. Percent identity with other species by BLAST analysis: Human (100%); Gibbon, Monkey, Rat (93%); Marmoset, Hamster, Elephant, Horse (87%); Mouse, Bat, Bovine (80%).

SLC1A5 / ASCT2 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Human
Conjugation Unconjugated
Immunogen SLC1A5 / ASCT2 antibody was raised against synthetic 17 amino acid peptide from internal region of human SLC1A5. Percent identity with other species by BLAST analysis: Human, Gibbon, Marmoset (100%); Monkey (94%); Dog, Horse (82%).

Anti-SLC1A5 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 211-224 amino acids of human solute carrier family 1 (neutral amino acid transporter), member 5