SLC1A5 Rabbit Polyclonal Antibody

CAT#: TA346411

Rabbit Polyclonal Anti-SLC1A5 Antibody

Product Images

WB Suggested Anti-SLC1A5 Antibody Titration: 2.5 ug/ml; Positive Control: Jurkat cell lysate; SLC1A5 is supported by BioGPS gene expression data to be expressed in Jurkat

• 

  Rabbit Anti-SLC1A5 Antibody; Paraffin Embedded Tissue: Human Kidney; Cellular Data: Epithelial cells of renal tubule; Antibody Concentration: 4.0-8.0 ug/ml; Magnification: 400X

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC1A5 antibody: synthetic peptide directed towards the middle region of human SLC1A5. Synthetic peptide located within the following region: FGVALRKLGPEGELLIRFFNSFNEATMVLVSWIMWYAPVGIMFLVAGKIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 60 kDa
• Gene Name: solute carrier family 1 member 5
• Database Link:
  NP_005619
  Entrez Gene 6510 Human
  UniProt ID Q15758
• Background: SLC1A5 has a broad substrate specificity, a preference for zwitterionic amino acids, and a sodium-dependence. It accepts as substrates all neutral amino acids, including glutamine, asparagine, and branched-chain and aromatic amino acids, and excludes methylated amino acids, anionic amino acids, and cationic amino acids. It acts as a cell surface receptor for feline endogenous virus RD114, baboon M7 endogenous virus and type D simian retroviruses.
• Synonyms: AAAT; ASCT2; ATBO; M7V1; M7VS1; R16; RDRC
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Sheep: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane