Antibodies

View as table Download

Rabbit Polyclonal ZIP6 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ZIP6 antibody was raised against a 16 amino acid synthetic peptide near the center of human ZIP6.

Rabbit Polyclonal Anti-SLC39A6 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-SLC39A6 Antibody: synthetic peptide directed towards the middle region of human SLC39A6. Synthetic peptide located within the following region: RSCLIHTSEKKAEIPPKTYSLQIAWVGGFIAISIISFLSLLGVILVPLMN

SLC39A6 / LIV-1 Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Gorilla, Human, Monkey
Conjugation Unconjugated
Immunogen SLC39A6 / LIV-1 antibody was raised against synthetic 18 amino acid peptide from N-terminus of human SLC39A6. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Orangutan, Gibbon, Horse (94%); Marmoset, Dog, Bovine, Panda (89%); Mouse, Rat, Bat, Rabbit (83%).

Anti-SLC39A6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 303-315 amino acids of Human solute carrier family 39 (zinc transporter), member 6

Anti-SLC39A6 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 303-315 amino acids of Human solute carrier family 39 (zinc transporter), member 6