Antibodies

Jump to Filters
View as table Download
CLDND1 Rabbit Polyclonal Antibody
TA349283

USD 380.00

In Stock

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CLDND1
CLDND1 (Center) Rabbit Polyclonal Antibody
AP50953PU-N

USD 450.00

2 Weeks

CLDND1 (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 50~80 amino acids from the Central region of human CLDND
CLDND1 Rabbit Polyclonal Antibody
TA335968

USD 375.00

5 Days

Rabbit Polyclonal Anti-CLDND1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CLDND1 Antibody: synthetic peptide directed towards the middle region of human CLDND1. Synthetic peptide located within the following region: TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL