SIRPG (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 192-221 amino acids from the Central region of Human SIRPG. |
SIRPG (Center) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 192-221 amino acids from the Central region of Human SIRPG. |
Rabbit polyclonal antibody to CD172 gamma (signal-regulatory protein gamma)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 298 of CD172 gamma (Uniprot ID#Q9P1W8) |
Rabbit polyclonal anti-SIRPG antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SIRPG. |
Rabbit Polyclonal Anti-SIRPG Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA |
EDEM3 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |