Rabbit Polyclonal Anti-ABI3BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABI3BP antibody is: synthetic peptide directed towards the C-terminal region of Human ABI3BP. Synthetic peptide located within the following region: PVSNTVAFSTESADPRVSEPVSAGRDAIWTERPFNSDSYSECKGKQYVKR |
Rabbit Polyclonal Anti-ABI3BP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ABI3BP antibody: synthetic peptide directed towards the N terminal of human ABI3BP. Synthetic peptide located within the following region: LINPHHDWTLPSHCPNDRFYTIRYREKDKEKKWIFQICPATETIVENLKP |
Anti-ABI3BP Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1020-1034 amino acids of human ABI family, member 3 (NESH) binding protein |
Rabbit Polyclonal Anti-ABI3BP Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ABI3BP |
Germany
Japan
United Kingdom
China
