Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-LRRC8A Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | LRRC8A antibody was raised against a 15 amino acid peptide near the amino terminus of human LRRC8A. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PMEPA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PMEPA1 antibody was raised against a 16 amino acid peptide near the center of human PMEPA1. |
Rabbit polyclonal Anti-LRRC8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRC8A antibody: synthetic peptide directed towards the N terminal of human LRRC8A. Synthetic peptide located within the following region: IPVTELRYFADTQPAYRILKPWWDVFTDYISIVMLMIAVFGGTLQVTQDK |
Rabbit polyclonal Anti-LRRC8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LRRC8A antibody: synthetic peptide directed towards the middle region of human LRRC8A. Synthetic peptide located within the following region: NLTQIELRGNRLECLPVELGECPLLKRSGLVVEEDLFNTLPPEVKERLWR |
Active filters
Target Symbol
- LRRC8A
Families
- Transmembrane