Rabbit Polyclonal Anti-TNFSF13B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFSF13B |
Rabbit Polyclonal Anti-TNFSF13B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human TNFSF13B |
Rabbit Polyclonal ORAI1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ORAI1 antibody was raised against a 16 amino acid synthetic peptide from near the carboxy terminus of human ORAI1. The immunogen is located within the last 50 amino acids of ORAI1. |
Mouse ORAI1 Monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal ORAI1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | ORAI1 antibody was raised against a 18 amino acid peptide from near the amino terminus of human ORAI1. |
Mouse ORAI1 Monoclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
ORAI1 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 152~181 amino acids from the Center region of human ORAI1 |
Rabbit Polyclonal Anti-Human Orai1 (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KKQPGQPRPTSK, corresponding to amino acid residues 203-214 of human Orai1. 2nd extracellular loop. |
Goat Anti-ORAI1 / CRACM1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-KKQPGQPRPTSKP, from the internal region of the protein sequence according to NP_116179.2. |
Rabbit Polyclonal Anti-ORAI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the N terminal of human ORAI1. Synthetic peptide located within the following region: HPEPAPPPSRSSPELPPSGGSTTSGSRRSRRRSGDGEPPGAPPPPPSAVT |
Rabbit Polyclonal Anti-ORAI1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ORAI1 antibody: synthetic peptide directed towards the middle region of human ORAI1. Synthetic peptide located within the following region: IGTLLFLAEVVLLCWVKFLPLKKQPGQPRPTSKPPASGAAANVSTSGITP |
Rabbit Polyclonal Anti-ORAI1(L1) Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ORAI1(L1) |
Rabbit Polyclonal Anti-ORAI1 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ORAI1 |