Germany
Japan
United Kingdom
China
SIRPG (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 192-221 amino acids from the Central region of Human SIRPG. |
Antibodies
View as table Download
Rabbit polyclonal antibody to CD172 gamma (signal-regulatory protein gamma)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 298 of CD172 gamma (Uniprot ID#Q9P1W8) |
Rabbit Polyclonal Anti-SIRPG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA |
EDEM3 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- SIRPG
Families
- Transmembrane