Rabbit Polyclonal Anti-CYP3A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: KSVKRMKESRLEDTQKHRVDFLQLMIDSQNSKETESHKALSDLELVAQSI |
Rabbit Polyclonal Anti-CYP3A4
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CYP3A4 antibody: synthetic peptide directed towards the middle region of human CYP3A4. Synthetic peptide located within the following region: MIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIG |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-PLA2G4B Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP |
Rabbit polyclonal anti-Cytochrome P450 (CYP1A2) antibody
| Reactivities | Human |
| Immunogen | Cytochrome P450 (CYP1A2) |
Sheep polyclonal anti-Cytochrome P450 2E1 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 2E1 |
Rabbit polyclonal anti-Cytochrome P450 (CYP2E1) antibody
| Reactivities | Human, Rat |
| Immunogen | Cytochrome P450 (CYP2E1) |
Sheep polyclonal anti-Cytochrome P450 3A4 antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYP 3A4 |
Rabbit polyclonal anti-Cytochrome P450 (CYP3A4) antibody
| Reactivities | Human |
| Immunogen | Cytochrome P450 (CYP3A4) |
Rabbit anti 15-Lox-1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Anti-AKR1B10 rabbit polyclonal antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-CYP3A4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 286 amino acids of human cytochrome P450, family 3, subfamily A, polypeptide 4 |
Rabbit Polyclonal Anti-PLA2G4A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PLA2G4A |
Rabbit Polyclonal Anti-CYP2E1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CYP2E1 |
Rabbit Polyclonal Anti-ALOX15 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human ALOX15 |
USD 345.00
In Stock
Rabbit Polyclonal Anti-PLA2G6 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLA2G6 |
Germany
Japan
United Kingdom
China
