JMJD7-PLA2G4B Rabbit Polyclonal Antibody

CAT#: TA343501

Rabbit Polyclonal Anti-PLA2G4B Antibody

Product Images

WB Suggested Anti-PLA2G4B Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PLA2G4B antibody: synthetic peptide directed towards the N terminal of human PLA2G4B. Synthetic peptide located within the following region: AEAALEAVRSELREFPAAARELCVPLAVPYLDKPPTPLHFYRDWVCPNRP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 114 kDa
• Gene Name: JMJD7-PLA2G4B readthrough
• Database Link:
  NP_005081
  Entrez Gene 8681 Human
• Background: PLA2G4B gene transcribes naturally-occurring mRNAs that are co-transcribed products of the neighboring JMJD7 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).The LOC100137047-PLA2G4B mRNAs are naturally occurring co-transcribed products of the neighboring LOC100137047 and PLA2G4B genes. Incompletely processed read-through transcripts from these two loci are abundantly expressed in most tissues, but the function of the predicted protein product has not yet been determined. Alternative splicing of this gene results in different transcript variants, some of which are candidates for nonsense-mediated decay (NMD).
• Synonyms: cPLA2-beta; HsT16992
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 93%; Horse: 93%; Rat: 90%; Pig: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Pathways: alpha-Linolenic acid metabolism, Arachidonic acid metabolism, Ether lipid metabolism, Fc epsilon RI signaling pathway, Glycerophospholipid metabolism, GnRH signaling pathway, Linoleic acid metabolism, Long-term depression, MAPK signaling pathway, Metabolic pathways, Vascular smooth muscle contraction, VEGF signaling pathway