Antibodies

View as table Download

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the middle region of human PYCR2. Synthetic peptide located within the following region: LDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRE

Rabbit Polyclonal Anti-PYCR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PYCR2 antibody: synthetic peptide directed towards the C terminal of human PYCR2. Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS