Antibodies

Jump to Filters
View as table Download
MBD4 Rabbit Polyclonal Antibody
TA347242

USD 358.00

5 Days

Rabbit Polyclonal MBD4 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: human MBD4 (Methyl-CpG-binding domain protein 4), using three different KLH-conjugated synthetic peptides.
MBD4 Rabbit Polyclonal Antibody
TA338199

USD 375.00

5 Days

Rabbit Polyclonal Anti-MBD4 Antibody

Applications Assay, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MBD4 antibody: synthetic peptide directed towards the middle region of human MBD4. Synthetic peptide located within the following region: CSEQKTSGIINKFCSAKDSEHNEKYEDTFLESEEIGTKVEVVERKEHLHT
MBD4 Rabbit Polyclonal Antibody
TA318862

USD 355.00

3 Weeks

Rabbit polyclonal anti-MBD4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 474 of mouse MBD4