Antibodies

Jump to Filters
View as table Download
NTH1 (NTHL1) Rabbit Polyclonal Antibody
TA338254

USD 375.00

5 Days

Rabbit Polyclonal Anti-NTHL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS
NTH1 (NTHL1) Rabbit Polyclonal Antibody
TA890138

USD 345.00

In Stock

Rabbit Polyclonal anti-NTHL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NTHL1
NTH1 (NTHL1) Rabbit Polyclonal Antibody
TA890138S

USD 159.00

2 Days

Rabbit Polyclonal anti-NTHL1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human NTHL1