Antibodies

Jump to Filters
View as table Download
CRKL Goat Polyclonal Antibody
TA302748

USD 375.00

5 Days

Goat Polyclonal Antibody against CRKL

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198.
CRKL Rabbit Monoclonal Antibody [Clone ID: EP270Y]
TA303464

USD 515.00

In Stock

Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Phospho-specific
CRKL Rabbit Polyclonal Antibody
TA329153

USD 375.00

5 Days

Rabbit Polyclonal anti-CRKL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS
CRKL Rabbit Polyclonal Antibody
TA351105

USD 345.00

In Stock

Rabbit Polyclonal Anti-CRKL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRKL