Goat Polyclonal Anti-VEGFR2 Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Goat Polyclonal Anti-VEGFR2 Antibody
Applications | WB |
Reactivities | Canine, Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Goat Polyclonal Anti-VEGFA Antibody
Applications | IF, WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human VEGFA isoform 6 produced in E. coli. |
Goat Polyclonal Anti-IL10 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human IL10 produced in E. coli. |
Goat Polyclonal Anti-ERBB1 Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant peptide derived from within residues 1,162 aa to the C-terminus of human ERBB1 produced in E. coli. |
Goat Polyclonal Anti-TNF alpha Antibody
Applications | WB |
Reactivities | Canine, Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Purified recombinant human TNF-_ produced in E. coli. |
Rabbit Polyclonal Anti-TNFRSF9 Antibody
Applications | WB |
Reactivities | Canine, Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL |