Antibodies

Jump to Filters
View as table Download
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA312303

USD 345.00

4 Weeks

Rabbit polyclonal anti-NKX61 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human NKX6-1.
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA331124

USD 375.00

5 Days

Rabbit Polyclonal Anti-NKX6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS