nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody

CAT#: TA331124

Rabbit Polyclonal Anti-NKX6

Product Images

WB Suggested Anti-NKX6-1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human Small Intestine

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 38 kDa
• Gene Name: NK6 homeobox 1
• Database Link:
  NP_006159
  Entrez Gene 18096 MouseEntrez Gene 4825 Human
  UniProt ID P78426
• Background: NKX6-1 is the transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. NKX6-1 is involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3, NKX6-1 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. NKX6-1 belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733]. [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-300 U66797.1 1-300 301-307 AC096766.3 119394-119400 c 308-676 U66797.1 308-676 677-849 U66798.1 7-179 850-1116 U66799.1 7-273
• Synonyms: NKX6.1; NKX6A
• Note: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 86%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Maturity onset diabetes of the young