Antibodies

Jump to Filters
View as table Download
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA309767

USD 512.00

In Stock

Rabbit Polyclonal Nkx6.1 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Nkx6.1 protein (within residues 50-200). [Swiss-Prot P78426]
nkx6.1 (NKX6-1) (C-term) Rabbit Polyclonal Antibody
AP52893PU-N

USD 512.00

2 Weeks

nkx6.1 (NKX6-1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 284-314aa) of human NKX6-1
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA312303

USD 345.00

4 Weeks

Rabbit polyclonal anti-NKX61 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human NKX6-1.
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA331124

USD 375.00

5 Days

Rabbit Polyclonal Anti-NKX6

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6-1 antibody: synthetic peptide directed towards the N terminal of human NKX6-1. Synthetic peptide located within the following region: MLAVGAMEGTRQSAFLLSSPPLAALHSMAEMKTPLYPAAYPPLPAGPPSS
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA355502

USD 360.00

5 Days

NKX6-1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human NKX61
nkx6.1 (NKX6-1) Rabbit Polyclonal Antibody
TA379147

USD 275.00

3 Weeks

NKX6-1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NKX6-1.
Modifications Unmodified