Antibodies

Jump to Filters
View as table Download
FUCA2 Rabbit Polyclonal Antibody
TA343213

USD 375.00

5 Days

Rabbit Polyclonal Anti-FUCA2 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Fuca2 antibody is: synthetic peptide directed towards the middle region of Mouse Fuca2. Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT