FUCA2 Rabbit Polyclonal Antibody

CAT#: TA343213

Rabbit Polyclonal Anti-FUCA2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "FUCA2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Mouse
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Fuca2 antibody is: synthetic peptide directed towards the middle region of Mouse Fuca2. Synthetic peptide located within the following region: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 54 kDa
Gene Name fucosidase, alpha-L- 2, plasma
Background Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
Synonyms dJ20N2.5
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 93%; Pig: 92%; Horse: 92%; Bovine: 92%; Zebrafish: 92%; Guinea pig: 92%; Dog
Reference Data
Protein Families Druggable Genome, Secreted Protein
Protein Pathways Other glycan degradation

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.