Antibodies

View as table Download

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the middle region of human DCP2. Synthetic peptide located within the following region: KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP

Rabbit Polyclonal Anti-DCP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DCP2 antibody: synthetic peptide directed towards the C terminal of human DCP2. Synthetic peptide located within the following region: VEKLSRTKFRHSQQLFPDGSPGDQWVKHRQPLQQKPYNNHSEMSDLLKGK

Rabbit Polyclonal DCP2 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DCP2 antibody was raised against an 18 amino acid synthetic peptide near the carboxy terminus of human DCP2.

Rabbit anti-DCP2 polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide conjugated to KLH