Antibodies

View as table Download

Rabbit Polyclonal Anti-VTI1a Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VTI1a antibody was raised against a 19 amino acid peptide near the center of human VTI1a.

Rabbit polyclonal anti-VTI1A antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human VTI1A.

Rabbit Polyclonal Anti-VTI1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-VTI1A antibody: synthetic peptide directed towards the N terminal of human VTI1A. Synthetic peptide located within the following region: SSDFEGYEQDFAVLTAEITSKIARVPRLPPDEKKQMVANVEKQLEEAKEL