Antibodies

Jump to Filters
View as table Download
HSPA1L Rabbit Polyclonal Antibody
TA327201

USD 275.00

3 Weeks

HSPA1L Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HSPA1L
HSPA1L Rabbit Polyclonal Antibody
TA335710

USD 375.00

5 Days

Rabbit Polyclonal Anti-HSPA1L Antibody

Applications WB
Reactivities Human, Lamprey, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD