Antibodies

Jump to Filters
View as table Download
U2AF65 (U2AF2) Rabbit Polyclonal Antibody
TA332467

USD 275.00

3 Weeks

Rabbit anti-U2AF2 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human U2AF2
U2AF65 (U2AF2) Rabbit Polyclonal Antibody
TA345731

USD 410.00

5 Days

Rabbit Polyclonal Anti-U2AF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-U2AF2 antibody: synthetic peptide directed towards the N terminal of human U2AF2. Synthetic peptide located within the following region: EFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSAS
U2AF65 (U2AF2) Rabbit Polyclonal Antibody
TA345732

USD 475.00

5 Days

Rabbit Polyclonal Anti-U2AF2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-U2AF2 antibody: synthetic peptide directed towards the C terminal of human U2AF2. Synthetic peptide located within the following region: TEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV