Antibodies

Jump to Filters
View as table Download
ACCN5 (ASIC5) Rabbit Polyclonal Antibody
TA331464

USD 310.00

5 Days

Rabbit polyclonal Anti-ACCN5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACCN5 antibody: synthetic peptide directed towards the middle region of human ACCN5. Synthetic peptide located within the following region: FTEYGNCFTFNHGETLQAKRKVSVSGRGLSLLFNVNQEAFTDNPALGFVD
ACCN5 (ASIC5) Rabbit Polyclonal Antibody
TA373741

USD 220.00

3 Weeks

ASIC5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 140-330 of human ASIC5 (NP_059115.1).
Modifications Unmodified