Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the middle region of human PAX4. Synthetic peptide located within the following region: RTIFSPSQAEALEKEFQRGQYPDSVARGKLATATSLPEDTVRVWFSNRRA |
Rabbit Polyclonal Anti-PAX4 Antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | The immunogen for anti-PAX4 antibody: synthetic peptide directed towards the N terminal of human PAX4. Synthetic peptide located within the following region: ISRILKVSNGCVSKILGRYYRTGVLEPKGIGGSKPRLATPPVVARIAQLK |
PAX4 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-200 of human PAX4 (NP_006184.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
