Antibodies

View as table Download

Rabbit Polyclonal Anti-Scn1b Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF

SCN1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence at the N-terminal of human SCN1B

Rabbit Polyclonal Anti-SCN1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS

Rabbit Polyclonal Anti-SCN1B Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B

SCN1B rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human SCN1B

SCN1B Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1).
Modifications Unmodified