Antibodies

View as table Download

Rabbit Polyclonal Anti-TRIM29 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM29

Rabbit Polyclonal Anti-TRIM29 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the N terminal of human TRIM29. Synthetic peptide located within the following region: EAADASRSNGSSPEARDARSPSGPSGSLENGTKADGKDAKTTNGHGGEAA

Rabbit Polyclonal Anti-TRIM29 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: SLKGYPSLMRSQSPKAQPQTWKSGKQTMLSHYRPFYVNKGNGIGSNEAP

Rabbit polyclonal anti-ATDC antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal ATDC Ac-K116 antibody

Applications WB
Reactivities Bovine, Chimpanzee, Human, Macaque, Horse
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a peptide corresponding to an internal portion of human ATDC protein around lysine 116.

Rabbit polyclonal TRIM29 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TRIM29 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 336-365 amino acids from the Central region of human TRIM29.

Rabbit Polyclonal Anti-TRIM29 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRIM29 antibody: synthetic peptide directed towards the middle region of human TRIM29. Synthetic peptide located within the following region: HKNHSTVTVEEAKAEKETELSLQKEQLQLKIIEIEDEAEKWQKEKDRIKS

TRIM29 rabbit polyclonal antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human TRIM29

TRIM29 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 309-588 of human TRIM29 (NP_036233.2).
Modifications Unmodified

TRIM29 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 309-588 of human TRIM29 (NP_036233.2).
Modifications Unmodified