Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-AHSA1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AHSA1. |
Antibodies
View as table Download
Rabbit polyclonal anti-AHA1 antibody
| Applications | WB |
| Reactivities | Chimpanzee, Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of human AHA1 protein. |
Rabbit Polyclonal Anti-AHSA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: VMKWRFKSWPEGHFATITLTFIDKNGETELCMEGRGIPAPEEERTRQGWQ |
Rabbit Polyclonal Anti-AHSA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AHSA1 antibody is: synthetic peptide directed towards the C-terminal region of Human AHSA1. Synthetic peptide located within the following region: NGESVDPVGQPALKTEERKAKPAPSKTQARPVGVKIPTCKITLKETFLTS |
AHA1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-338 of human AHA1 (NP_036243.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- AHSA1
Reactivities
- Human
Isotypes
- IgG