Antibodies

Jump to Filters
View as table Download
APOBEC1 Rabbit Polyclonal Antibody
TA345784

USD 475.00

5 Days

Rabbit Polyclonal Anti-APOBEC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-APOBEC1 antibody: synthetic peptide directed towards the N terminal of human APOBEC1. Synthetic peptide located within the following region: TSEKGPSTGDPTLRRRIEPWEFDVFYDPRELRKEACLLYEIKWGMSRKIW
APOBEC1 Goat Polyclonal Antibody
TA305633

USD 375.00

In Stock

Goat Anti-APOBEC1 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence DVFYDPRELRKEAC, from the internal region (near N Terminus) of the protein sequence according to NP_001635.2.
APOBEC1 Rabbit Polyclonal Antibody
TA366899

USD 380.00

4 Weeks

APOBEC1 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human APOBEC1