Antibodies

View as table Download

Rabbit Polyclonal BACE Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen BACE antibody was raised against a peptide corresponding to 17 amino acids at the carboxy terminus of human BACE.

Rabbit Polyclonal Anti-BACE1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BACE1 antibody: synthetic peptide directed towards the N terminal of human BACE1. Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Anti-BACE1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human beta-site APP-cleaving enzyme 1

BACE1 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 22-322 of human BACE1 (NP_036236.1).
Modifications Unmodified