Antibodies

Jump to Filters
View as table Download
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA343281

USD 375.00

2 Weeks

Rabbit Polyclonal Anti-CD81 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA306789

USD 430.00

2 Weeks

Rabbit Polyclonal CD81 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CD81 antibody was raised against a 20 amino acid peptide near the amino terminus of human CD81.
TAPA1 (CD81) Rabbit Polyclonal Antibody
TA374487

USD 220.00

3 Weeks

CD81 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CD81 (NP_004347.1).
Modifications Unmodified