TAPA1 (CD81) Rabbit Polyclonal Antibody

CAT#: TA343281

Rabbit Polyclonal Anti-CD81 Antibody


USD 375.00

2 Weeks*

Size
    • 100 ul

Product Images

Other products for "CD81"

Specifications

Product Data
Applications IHC, WB
Recommended Dilution Formalin Fixed Paraffin Embedded Tissue (Human Liver Tissue): 1:100
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-CD81 antibody is: synthetic peptide directed towards the C-terminal region of Human CD81. Synthetic peptide located within the following region: LKNNLCPSGSNIISNLFKEDCHQKIDDLFSGKLYLIGIAAIVVAVIMIFE
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 30 kDa
Gene Name CD81 molecule
Background The function of this protein remains unknown.
Synonyms CVID6; S5.7; TAPA1; TSPAN28
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Sheep: 92%; Pig: 86%; Goat: 83%; Bovine: 83%; Horse: 75%
Reference Data
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Transmembrane
Protein Pathways B cell receptor signaling pathway

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.