Antibodies

View as table Download

Rabbit Polyclonal Anti-CDK5RAP1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CDK5RAP1 antibody: synthetic peptide directed towards the N terminal of human CDK5RAP1. Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI

CDK5RAP1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-350 of human CDK5RAP1 (NP_057492.2).
Modifications Unmodified