CDK5RAP1 Rabbit Polyclonal Antibody

CAT#: TA345027

Rabbit Polyclonal Anti-CDK5RAP1 Antibody - N-terminal region

Product Images

WB Suggested Anti-CDK5RAP1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:1562500; Positive Control: Human brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CDK5RAP1 antibody: synthetic peptide directed towards the N terminal of human CDK5RAP1. Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: CDK5 regulatory subunit associated protein 1
• Database Link:
  NP_057492
  Entrez Gene 51654 Human
  UniProt ID Q96SZ6
• Background: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in
• Synonyms: C20orf34; C42; CGI-05; HSPC167
• Note: Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rabbit: 93%; Guinea pig: 86%