Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-FAP-1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAP-1 Antibody: A synthesized peptide derived from human FAP-1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FAP Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAP antibody is: synthetic peptide directed towards the C-terminal region of Human FAP. Synthetic peptide located within the following region: SWEYYASVYTERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTA |
Rabbit Polyclonal Anti-FAP Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FAP |
FAP rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FAP |
Fibroblast activation protein-α (FAP) Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 26-280 of human fibroblast activation protein-α (Fibroblast activation protein-α (FAP)) (NP_004451.2). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FAP
Reactivities
- Human
Isotypes
- IgG