Antibodies

View as table Download

Rabbit Polyclonal Anti-FZR1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN

FZR1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 224-493 of human FZR1 (NP_057347.2).
Modifications Unmodified