Antibodies

Jump to Filters
View as table Download
GSTM5 Rabbit Polyclonal Antibody
TA346675

USD 475.00

5 Days

Rabbit Polyclonal Anti-GSTM5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GSTM5 antibody: synthetic peptide directed towards the N terminal of human GSTM5. Synthetic peptide located within the following region: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEK
GSTM5 Rabbit Polyclonal Antibody
TA366618

USD 380.00

4 Weeks

GSTM5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GSTM5
GSTM5 Rabbit Polyclonal Antibody
TA370969

USD 380.00

4 Weeks

GSTM5 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GSTM5