Antibodies

Jump to Filters
View as table Download
KCNJ9 Rabbit Polyclonal Antibody
TA338552

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNJ9 antibody: synthetic peptide directed towards the middle region of human KCNJ9. Synthetic peptide located within the following region: CQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSAR
KCNJ9 Rabbit Polyclonal Antibody
TA351217

USD 345.00

In Stock

Rabbit Polyclonal Anti-KCNJ9 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9
KCNJ9 Rabbit Polyclonal Antibody
TA367064

USD 380.00

4 Weeks

KCNJ9 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNJ9