Antibodies

View as table Download

Rabbit Polyclonal Anti-LRRFIP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LRRFIP1 antibody: synthetic peptide directed towards the N terminal of human LRRFIP1. Synthetic peptide located within the following region: AEAREIRMKELERQQKEEDSERYSRRSRRNTSASDEDERMSVGSRGSLRV

Rabbit Polyclonal LRRFIP1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen LRRFIP1 antibody was raised against a 19 amino acid synthetic peptide near the carboxy terminus of human LRRFIP1.

LRRFIP1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 589-808 of human LRRFIP1 (NP_001131024.1).
Modifications Unmodified