Antibodies

View as table Download

Rabbit Polyclonal Anti-TAU Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TAU antibody was raised against a 19 amino acid peptide near the amino terminus of human TAU.

Rabbit Polyclonal Anti-MAGEA4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAGEA4 antibody: synthetic peptide directed towards the C terminal of human MAGEA4. Synthetic peptide located within the following region: ENYLEYRQVPGSNPARYEFLWGPRALAETSYVKVLEHVVRVNARVRIAYP

Anti-MAGEA4 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-MAGEA4 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

MAGEA4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 28-317 of human MAGEA4 (NP_002353.3).
Modifications Unmodified