Antibodies

Jump to Filters
View as table Download
THRAP3 Rabbit Polyclonal Antibody
TA343506

USD 375.00

5 Days

Rabbit Polyclonal Anti-THRAP3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-THRAP3 antibody: synthetic peptide directed towards the middle region of human THRAP3. Synthetic peptide located within the following region: GRGAFPRGRGRFMFRKSSTSPKWAHDKFSGEEGEIEDDESGTENREEKDN
THRAP3 Rabbit Polyclonal Antibody
TA353506L

USD 1,255.00

5 Days

Rabbit polyclonal anti-THRAP3 antibody

Reactivities Human
Conjugation Unconjugated
Immunogen THRAP3
THRAP3 Rabbit Polyclonal Antibody
TA382510

USD 220.00

3 Weeks

THRAP3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human THRAP3
Modifications Unmodified