Antibodies

View as table Download

Rabbit Polyclonal Anti-KLF11 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KLF11

Rabbit polyclonal TIEG2 Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TIEG2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 7-36 amino acids from the N-terminal region of human TIEG2.

Rabbit Polyclonal Anti-KLF11 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-KLF11 Antibody: A synthesized peptide derived from human KLF11

Rabbit polyclonal anti-KLF11 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human KLF11.

Rabbit polyclonal anti-Klf11 antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Klf11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH

KLF11 rabbit polyclonal antibody

Applications ELISA, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human KLF11

KLF11 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human KLF11.