Klf11 Rabbit Polyclonal Antibody

CAT#: TA329622

Rabbit polyclonal anti-Klf11 antibody

Product Images

WB Suggested Anti-Klf11 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Brain

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Klf11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 54 kDa
• Gene Name: Kruppel-like factor 11
• Database Link:
  NP_848134
  Entrez Gene 194655 Mouse
  UniProt ID Q8K1S5
• Background: Klf11 is a transcription factor. Klf11 activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding sites inhibiting cell growth.Klf11 represses transcription of SMAD7 which enhances TGF-beta signaling. Klf11 also induces apoptosis.
• Synonyms: FKLF; FKLF1; MODY7; TIEG-2; TIEG2; Tieg3
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 92%