Klf11 Rabbit Polyclonal Antibody
Other products for "Klf11"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Klf11 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: PASGSSCRAVMTSVIRHTGESPAPTRFPTGPTQEQRASDSGEGQERLLDH |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 54 kDa |
Gene Name | Kruppel-like factor 11 |
Database Link | |
Background | Klf11 is a transcription factor. Klf11 activates the epsilon- and gamma-globin gene promoters and, to a much lower degree, the beta-globin gene and represses promoters containing SP1-like binding sites inhibiting cell growth.Klf11 represses transcription of SMAD7 which enhances TGF-beta signaling. Klf11 also induces apoptosis. |
Synonyms | FKLF; FKLF1; MODY7; TIEG-2; TIEG2; Tieg3 |
Note | Immunogen sequence homology: Mouse: 100%; Rat: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.