Rabbit Polyclonal Anti-LGALS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM |
Anti-LGALS1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Galectin 1/LGALS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-135 of human Galectin 1/Galectin 1/LGALS1 (NP_002296.1). |
| Modifications | Unmodified |
Galectin 1 Rabbit polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human Galectin 1 |
Germany
Japan
United Kingdom
China
