Galectin 1 (LGALS1) Rabbit Polyclonal Antibody
Frequently bought together (3)
Transient overexpression lysate of lectin, galactoside-binding, soluble, 1 (LGALS1)
USD 325.00
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
USD 159.00
Other products for "LGALS1"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | IHC, WB |
Reactivities | Human, Mouse |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 15 kDa |
Gene Name | galectin 1 |
Database Link | |
Background | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications. |
Synonyms | GAL1; GBP |
Note | Immunogen Sequence Homology: Goat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.