Galectin 1 (LGALS1) Rabbit Polyclonal Antibody

CAT#: TA344315

Rabbit Polyclonal Anti-LGALS1 Antibody - middle region

Product Images

WB Suggested Anti-LGALS1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human Muscle

• 

  Mouse macrophages

Specifications

Product Data

• Applications: WB
• Recommended Dilution: IHC, WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 15 kDa
• Gene Name: galectin 1
• Database Link:
  NP_002296
  Entrez Gene 16852 MouseEntrez Gene 3956 Human
  UniProt ID P09382
• Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation.The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS1 may act as an autocrine negative growth factor that regulates cell proliferation. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: GAL1; GBP
• Note: Immunogen Sequence Homology: Goat: 100%; Human: 100%; Sheep: 100%; Bovine: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome