Galectin 1 (LGALS1) (NM_002305) Human Recombinant Protein

CAT#: TP304674

Recombinant protein of human lectin, galactoside-binding, soluble, 1 (LGALS1)

Product Images

Coomassie blue staining of purified LGALS1 protein (Cat# TP304674). The protein was produced from HEK293T cells transfected with LGALS1 cDNA clone (Cat# RC204674) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC204674 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MACGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWG
  TEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002296
• Locus ID: 3956
• UniProt ID: P09382, A0A384MR27
• Cytogenetics: 22q13.1
• Refseq Size: 586
• Refseq ORF: 405
• Synonyms: GAL1; GBP
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. This gene product may act as an autocrine negative growth factor that regulates cell proliferation. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome